0
Home Products Antibodies Primary antibodies Secondary antibodies Tag antibodies Loading control antibodies Premium polyclonal antibodies Recombinant rabbit mAbs Mouse mAbs Phosphorylated antibodies Methylation antibodies Acetylated antibodies Biochemicals Research Areas
Service & Support Custom Services Support Promotion About Us
Sign In Sign Up

MUC16/CA125 Antibody  (Cat.#:AYP5401)

A
小A Scan to ask
Host: RabbitClonality: PolyclonalReactivity: HumanIFELISA
Datasheet    Copy details    Copy citation
Cat.# AYP5401
Target / gene MUC16
Host Rabbit
Clonality Polyclonal
Reactivity Human
Application IF, ELISA

暂无验证图

欢迎提交实验图片，或联系 Support 获取更多信息。

Cat.#：AYP5401

SizePrice
50 μL ￥1150.00 Add to cart
100 μL ￥2100.00 Add to cart

Promotion  |  Support

Sales Terms  |  Request COA  |  Stock and shipping are confirmed by support

  • Information

  • Application guide

  • Related products

  • Immunogen

  • Target data

  • Resources

  • FAQs

Reactivity Human
Host Rabbit
Clonality Polyclonal
Isotype IgG
Application IFELISA
Dilution IF: 1:50 - 1:200
Predicted MW 1519kDa
Observed MW
Format Liquid
Storage Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.75% BSA,50% glycerol,pH7.3.
Conjugate Unconjugated
Positive OVCAR3
Subcellular extracellular exosome,Golgi lumen,plasma membrane
Purification Affinity purification

Applications and conditions

Where to start

These starting conditions come from the recommended dilution, validation images, and general assay practice. Titrate for your sample and detection system.

IF Conditions for IF
Recommended dilution 1:50 - 1:200
Suggested sample / positive control OVCAR3
Key conditions Optimize fixation, permeabilization, and blocking, and include a secondary-only control
Expected result Expected fluorescence localization: extracellular exosome,Golgi lumen,plasma membrane
Controls Include a positive sample, a negative sample, and a secondary or isotype control
ELISA Conditions for ELISA
Recommended dilution See the validation images or contact technical support
Suggested sample / positive control OVCAR3
Key conditions Start at the recommended dilution and titrate for your sample and assay
Expected result Expected signal or band near 1519kDa
Controls Include a positive sample, a negative sample, and a secondary or isotype control

Related products

More associated products >>
MUC16 (YD12011) Rabbit mAb
Same target
AYD15848
MUC16 (YD12011) Rabbit mAb
WB, IHC-P
 MUC16 Rabbit mAb
Same target
AYM28781
MUC16 Rabbit mAb
WB,ICC/IF,FC
 CA125 / MUC16 Rabbit mAb
Same target
AYM30887
CA125 / MUC16 Rabbit mAb
WB,IHC

Immunogen

Immunogen Synthesized peptide derived from Human MUC16/CA125.
Sequence
View sequence 
TSTPGTSTVDVGTSGTPSSSPSPTTAGPLLMPFTLNFTITNLQYEEDMRRTGSRKFNTMESVLQGLLKPLFKNTSVGPLYSGCRLTLLRPEKDGAATGVDA

Target data

Background This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes.
Gene ID 94025
Gene name MUC16
Swiss Q8WXI7
Synonym CA125,MUC16/CA125 Antibody,MUC16,Ovarian cancer-related tumor marker CA125,Ovarian carcinoma antigen CA125,MUC16/CA125
Expression Expressed in corneal and conjunctival epithelia (at protein level). Overexpressed in ovarian carcinomas and ovarian low malignant potential (LMP) tumors as compared to the expression in normal ovarian tissue and ovarian adenomas.
Functions Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Research area

Resources

Validation data

Contact technical support for validation images and application examples.

References

No papers are linked yet. Contact technical support for application examples.

Ask for examples
Customer reviews

No reviews yet. After use, you can submit a review and experiment images.

Send feedback
Support

Support can help confirm the application, sample, dilution, controls, and assay conditions.

Support center
Need help with the application?

Send the catalog number, application, sample type, and assay. Support can confirm dilution, controls, and COA or lot documents.

Support Request COA

FAQs

Listed applications: IF, ELISA. Use the validation images and recommended dilution as a starting point.
Send the catalog number and lot through the inquiry form. Support will help with the lot documents.
Use the recommended conditions as a starting concentration. Sample, fixation, and detection system may need a titration.
AYP5401